GGT1 (Human) Recombinant Protein
  • GGT1 (Human) Recombinant Protein

GGT1 (Human) Recombinant Protein

Ref: AB-H00002678-G01
GGT1 (Human) Recombinant Protein

Información del producto

Human GGT1 full-length ORF (NP_005256.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name GGT1
Gene Alias CD224|D22S672|D22S732|GGT|GTG|MGC96892|MGC96904|MGC96963
Gene Description gamma-glutamyltransferase 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MKKKLVVLGLLAVVLVLVIVGLCLWLPSASKEPDNHVYTRAAVAADAKQCSKIGRDALRDGGSAVDAAIAALLCVGLMNAHSMGIGGGLFLTIYNSTTRKAEVINAREVAPRLAFATMFNSSEQSQKGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLARQGFPVGKGLAAALENKRTVIEQQPVLCEVFCRDRKVLREGERLTLPQLADTYETLAIEGAQAFYNGSLTAQIVKDIQAAGGIVTAEDLNN
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 2678

Enviar un mensaje


GGT1 (Human) Recombinant Protein

GGT1 (Human) Recombinant Protein