AB-H00002652-G01
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Size | 2 ug |
Gene Name | OPN1MW |
Gene Alias | CBBM|CBD|GCP|MGC176615|OPN1MW1 |
Gene Description | opsin 1 (cone pigments), medium-wave-sensitive |
Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
Application Key | AP |
Immunogen Prot. Seq | MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWVYHLTSVWMIFVVIASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISVVNQVYGYFVLGHPMCVLEGYTVSLCGITGLWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWAAVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMVTCCITPLSIIVLCYLQVWLAIRAVAKQQKE |
Form | Liquid |
Recomended Dilution | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Antigen species Target species | Human |
Storage Buffer | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene ID | 2652 |