GABRA2 (Human) Recombinant Protein
  • GABRA2 (Human) Recombinant Protein

GABRA2 (Human) Recombinant Protein

Ref: AB-H00002555-G01
GABRA2 (Human) Recombinant Protein

Información del producto

Human GABRA2 full-length ORF (ADZ15724.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name GABRA2
Gene Alias FLJ97076
Gene Description gamma-aminobutyric acid (GABA) A receptor, alpha 2
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MKTKLNIYNMQFLLFVFLVWDPARLVLANIQEDEAKNNITIFTRILDRLLDGYDNRLRPGLGDSITEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLKFKGPMNILRLNNLMASKIWTPDTFFHNGKKSAAHNMTMPNKLLRIQDDGTLLYTMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQSIGKETIKSSTGEYTVMTAHFHLKRKIGYFVI
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 2555

Enviar un mensaje


GABRA2 (Human) Recombinant Protein

GABRA2 (Human) Recombinant Protein