GABBR1 (Human) Recombinant Protein
  • GABBR1 (Human) Recombinant Protein

GABBR1 (Human) Recombinant Protein

Ref: AB-H00002550-G01
GABBR1 (Human) Recombinant Protein

Información del producto

Human GABBR1 full-length ORF (NP_068703.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name GABBR1
Gene Alias FLJ92613|GABAB(1e)|GABABR1|GABBR1-3|GPRC3A|dJ271M21.1.1|dJ271M21.1.2|hGB1a
Gene Description gamma-aminobutyric acid (GABA) B receptor, 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MGPGAPFARVGWPLPLLVVMAAGVAPVWASHSPHLPRPHSRVPPHPSSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFYETEAR
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 2550

Enviar un mensaje


GABBR1 (Human) Recombinant Protein

GABBR1 (Human) Recombinant Protein