DARC (Human) Recombinant Protein
  • DARC (Human) Recombinant Protein

DARC (Human) Recombinant Protein

Ref: AB-H00002532-G01
DARC (Human) Recombinant Protein

Información del producto

Human DARC full-length ORF (NP_002027.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name DARC
Gene Alias CCBP1|CD234|Dfy|FY|GPD|GpFy|WBCQ1
Gene Description Duffy blood group, chemokine receptor
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWP
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 2532

Enviar un mensaje


DARC (Human) Recombinant Protein

DARC (Human) Recombinant Protein