F2R (Human) Recombinant Protein
  • F2R (Human) Recombinant Protein

F2R (Human) Recombinant Protein

Ref: AB-H00002149-G01
F2R (Human) Recombinant Protein

Información del producto

Human F2R full-length ORF (AAH02464.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name F2R
Gene Alias CF2R|HTR|PAR1|TR
Gene Description coagulation factor II (thrombin) receptor
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLKEQTIQVPGLNITTCH
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 2149

Enviar un mensaje


F2R (Human) Recombinant Protein

F2R (Human) Recombinant Protein