ERBB4 (Human) Recombinant Protein (P01)
  • ERBB4 (Human) Recombinant Protein (P01)

ERBB4 (Human) Recombinant Protein (P01)

Ref: AB-H00002066-P01
ERBB4 (Human) Recombinant Protein (P01)

Información del producto

Human ERBB4 full-length ORF (NP_005226.1, 1 a.a. - 1308 a.a.) recombinant protein with GST tag at N-terminal.
Información adicional
Size 2 ug
Gene Name ERBB4
Gene Alias HER4|MGC138404|p180erbB4
Gene Description v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MKPATGLWVWVSLLVAAGTVQPSDSQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDS
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 2066

Enviar un mensaje


ERBB4 (Human) Recombinant Protein (P01)

ERBB4 (Human) Recombinant Protein (P01)