EMR1 (Human) Recombinant Protein
  • EMR1 (Human) Recombinant Protein

EMR1 (Human) Recombinant Protein

Ref: AB-H00002015-G01
EMR1 (Human) Recombinant Protein

Información del producto

Human EMR1 full-length ORF (AAH59395.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name EMR1
Gene Alias TM7LN3
Gene Description egf-like module containing, mucin-like, hormone receptor-like 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MRGFNLLLFWGCCVMHSWEGHIRPTRKPNTKGNNCRDSTLCPAYATCTNTVDSYYCACKQGFLSSNGQNHFKDPGVRCKDIDECSQSPQPCGPNSSCKNLSGRYKCSCLDGFSSPTGNDWVPGKPGNFSCTDINECLTSSVCPEHSDCVNSMGSYSCSCQVGFISRNSTCEDVDECADPRACPEHATCNNTVGNYSCFCNPGFESSSGHLSFQGLKASCEDIDECTEMCPINSTCTNTPGSYFCTCHPGFAPSNG
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 2015

Enviar un mensaje


EMR1 (Human) Recombinant Protein

EMR1 (Human) Recombinant Protein