EDNRA (Human) Recombinant Protein (P01)
  • EDNRA (Human) Recombinant Protein (P01)

EDNRA (Human) Recombinant Protein (P01)

Ref: AB-H00001909-P01
EDNRA (Human) Recombinant Protein (P01)

Información del producto

Human EDNRA full-length ORF ( ENSP00000315011, 1 a.a. - 427 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name EDNRA
Gene Alias ETA|ETRA
Gene Description endothelin receptor type A
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVK
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 1909

Enviar un mensaje


EDNRA (Human) Recombinant Protein (P01)

EDNRA (Human) Recombinant Protein (P01)