S1PR1 (Human) Recombinant Protein
  • S1PR1 (Human) Recombinant Protein

S1PR1 (Human) Recombinant Protein

Ref: AB-H00001901-G01
S1PR1 (Human) Recombinant Protein

Información del producto

Human S1PR1 full-length ORF (NP_001391.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name S1PR1
Gene Alias CHEDG1|D1S3362|ECGF1|EDG-1|EDG1|FLJ58121|S1P1
Gene Description sphingosine-1-phosphate receptor 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 1901

Enviar un mensaje


S1PR1 (Human) Recombinant Protein

S1PR1 (Human) Recombinant Protein