DSG1 (Human) Recombinant Protein (P01)
  • DSG1 (Human) Recombinant Protein (P01)

DSG1 (Human) Recombinant Protein (P01)

Ref: AB-H00001828-P01
DSG1 (Human) Recombinant Protein (P01)

Información del producto

Human DSG1 full-length ORF ( AAI53002.1, 1 a.a. - 1049 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name DSG1
Gene Alias CDHF4|DG1|DSG
Gene Description desmoglein 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MDWSFFRVVAMLFIFLVVVEVNSEFRIQVRDYNTKNGTIKWHSIRRQKREWIKFAAACREGEDNSKRNPIAKIHSDCAANQQVTYRISGVGIDQPPYGIFVINQKTGEINITSIVDREVTPFFIIYCRALNSMGQDLERPLELRVRVLDINDNPPVFSMATFAGQIEENSNANTLVMILNATDADEPNNLNSKIAFKIIRQEPSDSPMFIINRNTGEIRTMNNFLDREQYGQYALAVRGSDRDGGADGMSAECEC
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 1828

Enviar un mensaje


DSG1 (Human) Recombinant Protein (P01)

DSG1 (Human) Recombinant Protein (P01)