DRD5 (Human) Recombinant Protein
  • DRD5 (Human) Recombinant Protein

DRD5 (Human) Recombinant Protein

Ref: AB-H00001816-G01
DRD5 (Human) Recombinant Protein

Información del producto

Human DRD5 full-length ORF (ABM82859.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name DRD5
Gene Alias DBDR|DRD1B|DRD1L2|MGC10601
Gene Description dopamine receptor D5
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVLVCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFDIMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNWHRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAQVQ
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 1816

Enviar un mensaje


DRD5 (Human) Recombinant Protein

DRD5 (Human) Recombinant Protein