DRD1 (Human) Recombinant Protein
  • DRD1 (Human) Recombinant Protein

DRD1 (Human) Recombinant Protein

Ref: AB-H00001812-G01
DRD1 (Human) Recombinant Protein

Información del producto

Human DRD1 full-length ORF (NP_000785.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name DRD1
Gene Alias DADR|DRD1A
Gene Description dopamine receptor D1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLAETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKNCQTTTGNGKPVECSQ
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 1812

Enviar un mensaje


DRD1 (Human) Recombinant Protein

DRD1 (Human) Recombinant Protein