CNR2 (Human) Recombinant Protein (P01)
  • CNR2 (Human) Recombinant Protein (P01)

CNR2 (Human) Recombinant Protein (P01)

Ref: AB-H00001269-P01
CNR2 (Human) Recombinant Protein (P01)

Información del producto

Human CNR2 full-length ORF ( NP_001832.1, 1 a.a. - 360 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name CNR2
Gene Alias CB2|CX5
Gene Description cannabinoid receptor 2 (macrophage)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLL
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 1269

Enviar un mensaje


CNR2 (Human) Recombinant Protein (P01)

CNR2 (Human) Recombinant Protein (P01)