CNR2 (Human) Recombinant Protein
  • CNR2 (Human) Recombinant Protein

CNR2 (Human) Recombinant Protein

Ref: AB-H00001269-G01
CNR2 (Human) Recombinant Protein

Información del producto

Human CNR2 full-length ORF (NP_001832.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name CNR2
Gene Alias CB2|CX5
Gene Description cannabinoid receptor 2 (macrophage)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 1269

Enviar un mensaje


CNR2 (Human) Recombinant Protein

CNR2 (Human) Recombinant Protein