CCR8 (Human) Recombinant Protein
  • CCR8 (Human) Recombinant Protein

CCR8 (Human) Recombinant Protein

Ref: AB-H00001237-G01
CCR8 (Human) Recombinant Protein

Información del producto

Human CCR8 full-length ORF (NP_005192.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name CCR8
Gene Alias CDw198|CKR-L1|CKRL1|CMKBR8|CMKBRL2|CY6|GPR-CY6|MGC129966|MGC129973|TER1
Gene Description chemokine (C-C motif) receptor 8
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGKLLLAVFYCLLFVFSLLGNSLVILVLVVCKKLRSITDVYLLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSVDRYLAVVHAVYALKVRTIRMGTTLCLAVWLTAIMATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFTIFMFCYIKILHQLKRCQNHNKTKAIRLVLIVVIASLLFWVPFN
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 1237

Enviar un mensaje


CCR8 (Human) Recombinant Protein

CCR8 (Human) Recombinant Protein