CLCN1 (Human) Recombinant Protein
  • CLCN1 (Human) Recombinant Protein

CLCN1 (Human) Recombinant Protein

Ref: AB-H00001180-G01
CLCN1 (Human) Recombinant Protein

Información del producto

Human CLCN1 full-length ORF (AAI11587.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name CLCN1
Gene Alias CLC1|MGC138361|MGC142055
Gene Description chloride channel 1, skeletal muscle
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MEQSRSQQRGGEQSWWGSDPQYQYMPFEHCTSYGLPSENGGLQHRLRKDAGPRHNVHPTQIYGHHKEQFSDREQDIGMPKKTGSSSTVDSKDEDHYSKCQDCIHRLGQVVRRKLGEDGIFLVLLGLLMALVSWSMDYVSAKSLQAYKWSYAQMQPSLPLQFLVWVTFPLVLILFSALFCHLISPQAVGSGIPEMKTILRGVVLKEYLTMKAFVAKVVALTAGLGSGIPVGKEGPFVHIASICAAVLSKFMSVFCG
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 1180

Enviar un mensaje


CLCN1 (Human) Recombinant Protein

CLCN1 (Human) Recombinant Protein