CEBPB (Human) Recombinant Protein (P01)
  • CEBPB (Human) Recombinant Protein (P01)

CEBPB (Human) Recombinant Protein (P01)

Ref: AB-H00001051-P01
CEBPB (Human) Recombinant Protein (P01)

Información del producto

Human CEBPB full-length ORF ( AAH21931.1, 1 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name CEBPB
Gene Alias C/EBP-beta|CRP2|IL6DBP|LAP|MGC32080|NF-IL6|TCF5
Gene Description CCAAT/enhancer binding protein (C/EBP), beta
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPA
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 1051

Enviar un mensaje


CEBPB (Human) Recombinant Protein (P01)

CEBPB (Human) Recombinant Protein (P01)