CDH2 (Human) Recombinant Protein Ver mas grande

CDH2 (Human) Recombinant Protein

AB-H00001000-H01

Producto nuevo

CDH2 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 2 ug
Gene Name CDH2
Gene Alias CD325|CDHN|CDw325|NCAD
Gene Description cadherin 2, type 1, N-cadherin (neuronal)
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Concentration &ge
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq DWVISPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDREQIARFHLRAHAVDINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRIVSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDIIVANLTVTDKDQPHTP
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293T cells
Gene ID 1000

Más información

Purified CDH2 (ACE87575.1 160 a.a. - 724 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.

Consulta sobre un producto

CDH2 (Human) Recombinant Protein

CDH2 (Human) Recombinant Protein