CDH2 (Human) Recombinant Protein
  • CDH2 (Human) Recombinant Protein

CDH2 (Human) Recombinant Protein

Ref: AB-H00001000-H01
CDH2 (Human) Recombinant Protein

Información del producto

Purified CDH2 (ACE87575.1 160 a.a. - 724 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size 2 ug
Gene Name CDH2
Gene Alias CD325|CDHN|CDw325|NCAD
Gene Description cadherin 2, type 1, N-cadherin (neuronal)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration &ge
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq DWVISPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDREQIARFHLRAHAVDINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRIVSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDIIVANLTVTDKDQPHTP
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293T cells
Gene ID 1000

Enviar un mensaje


CDH2 (Human) Recombinant Protein

CDH2 (Human) Recombinant Protein