CD79B (Human) Recombinant Protein
  • CD79B (Human) Recombinant Protein

CD79B (Human) Recombinant Protein

Ref: AB-H00000974-G01
CD79B (Human) Recombinant Protein

Información del producto

Human CD79B full-length ORF (NP_000617.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name CD79B
Gene Alias B29|IGB
Gene Description CD79b molecule, immunoglobulin-associated beta
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 974

Enviar un mensaje


CD79B (Human) Recombinant Protein

CD79B (Human) Recombinant Protein