CD63 (Human) Recombinant Protein
  • CD63 (Human) Recombinant Protein

CD63 (Human) Recombinant Protein

Ref: AB-H00000967-G01
CD63 (Human) Recombinant Protein

Información del producto

Human CD63 full-length ORF (NP_001771.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name CD63
Gene Alias LAMP-3|ME491|MLA1|OMA81H|TSPAN30
Gene Description CD63 molecule
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 967

Enviar un mensaje


CD63 (Human) Recombinant Protein

CD63 (Human) Recombinant Protein