CD53 (Human) Recombinant Protein
  • CD53 (Human) Recombinant Protein

CD53 (Human) Recombinant Protein

Ref: AB-H00000963-G01
CD53 (Human) Recombinant Protein

Información del producto

Human CD53 full-length ORF (NP_000551.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name CD53
Gene Alias MOX44|TSPAN25
Gene Description CD53 molecule
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 963

Enviar un mensaje


CD53 (Human) Recombinant Protein

CD53 (Human) Recombinant Protein