CD47 (Human) Recombinant Protein Ver mas grande

CD47 (Human) Recombinant Protein

AB-H00000961-H01

Producto nuevo

CD47 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 8 Biopuntos. Su cesta contiene un total 8 Biopuntos puede ser convertido en un Biobonos Descuento 32.00EUR.


Hoja técnica

Size 25 ug
Gene Name CD47
Gene Alias IAP|MER6|OA3
Gene Description CD47 molecule
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Concentration &ge
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293H cells
Gene ID 961

Más información

Purified CD47 (NP_001768.1, 19 a.a. - 141 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.

Consulta sobre un producto

CD47 (Human) Recombinant Protein

CD47 (Human) Recombinant Protein