CD47 (Human) Recombinant Protein
  • CD47 (Human) Recombinant Protein

CD47 (Human) Recombinant Protein

Ref: AB-H00000961-H01
CD47 (Human) Recombinant Protein

Información del producto

Purified CD47 (NP_001768.1, 19 a.a. - 141 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size 25 ug
Gene Name CD47
Gene Alias IAP|MER6|OA3
Gene Description CD47 molecule
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration &ge
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293H cells
Gene ID 961

Enviar un mensaje


CD47 (Human) Recombinant Protein

CD47 (Human) Recombinant Protein