Ver mas grande
CD40 (Human) Recombinant Protein
AB-H00000958-H04
Producto nuevo
CD40 (Human) Recombinant Protein
Comprando este producto generará 8 Biopuntos. Su cesta contiene un total 8 Biopuntos puede ser convertido en un Biobonos Descuento 32.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | CD40 |
| Gene Alias | Bp50|CDW40|MGC9013|TNFRSF5|p50 |
| Gene Description | CD40 molecule, TNF receptor superfamily member 5 |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Concentration | >= 10 ug/ml |
| Application Key | WB,ELISA,SDS-PAGE,PI |
| Immunogen Prot. Seq | EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE and Western Blot |
| Storage Buffer | HIS Elution Buffer |
| Host | Human HEK293H cells |
| Gene ID | 958 |
Más información
Purified CD40 (AAH12419.1 , 21 a.a. - 193 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.