CD40 (Human) Recombinant Protein
  • CD40 (Human) Recombinant Protein

CD40 (Human) Recombinant Protein

Ref: AB-H00000958-G01
CD40 (Human) Recombinant Protein

Información del producto

Human CD40 full-length ORF (AAH12419.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name CD40
Gene Alias Bp50|CDW40|MGC9013|TNFRSF5|p50
Gene Description CD40 molecule, TNF receptor superfamily member 5
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 958

Enviar un mensaje


CD40 (Human) Recombinant Protein

CD40 (Human) Recombinant Protein