TNFSF8 (Human) Recombinant Protein
  • TNFSF8 (Human) Recombinant Protein

TNFSF8 (Human) Recombinant Protein

Ref: AB-H00000944-H01
TNFSF8 (Human) Recombinant Protein

Información del producto

Purified TNFSF8 (AAH93630.1, 63 a.a. - 234 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size 25 ug
Gene Name TNFSF8
Gene Alias CD153|CD30L|CD30LG|MGC138144
Gene Description tumor necrosis factor (ligand) superfamily, member 8
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration &ge
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293T cells
Gene ID 944

Enviar un mensaje


TNFSF8 (Human) Recombinant Protein

TNFSF8 (Human) Recombinant Protein