TNFSF8 (Human) Recombinant Protein
  • TNFSF8 (Human) Recombinant Protein

TNFSF8 (Human) Recombinant Protein

Ref: AB-H00000944-G01
TNFSF8 (Human) Recombinant Protein

Información del producto

Human TNFSF8 full-length ORF (NP_001235.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name TNFSF8
Gene Alias CD153|CD30L|CD30LG|MGC138144
Gene Description tumor necrosis factor (ligand) superfamily, member 8
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 944

Enviar un mensaje


TNFSF8 (Human) Recombinant Protein

TNFSF8 (Human) Recombinant Protein