CD3E (Human) Recombinant Protein
  • CD3E (Human) Recombinant Protein

CD3E (Human) Recombinant Protein

Ref: AB-H00000916-G01
CD3E (Human) Recombinant Protein

Información del producto

Human CD3E full-length ORF (NP_000724.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name CD3E
Gene Alias FLJ18683|T3E|TCRE
Gene Description CD3e molecule, epsilon (CD3-TCR complex)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 916

Enviar un mensaje


CD3E (Human) Recombinant Protein

CD3E (Human) Recombinant Protein