BMPR1A (Human) Recombinant Protein
  • BMPR1A (Human) Recombinant Protein

BMPR1A (Human) Recombinant Protein

Ref: AB-H00000657-G01
BMPR1A (Human) Recombinant Protein

Información del producto

Human BMPR1A full-length ORF (NP_004320.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name BMPR1A
Gene Alias 10q23del|ACVRLK3|ALK3|CD292
Gene Description bone morphogenetic protein receptor, type IA
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRWLVLLISMAVCIIAMIIFSSCFCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRG
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 657

Enviar un mensaje


BMPR1A (Human) Recombinant Protein

BMPR1A (Human) Recombinant Protein