Ver mas grande
BBS1 (Human) Recombinant Protein (P01)
AB-H00000582-P01
Producto nuevo
BBS1 (Human) Recombinant Protein (P01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 2 ug |
| Gene Name | BBS1 |
| Gene Alias | BBS2L2|FLJ23590|MGC126183|MGC126184|MGC51114 |
| Gene Description | Bardet-Biedl syndrome 1 |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Application Key | ELISA,WB-Re,AP,Array |
| Immunogen Prot. Seq | MSPGPQLWHLLQALVSMCIRISDPTSSSAYPNCLQILWNKTFGTRPKRETAEEPLSIQSLRFLQLELSEMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILAKMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILRRDSKHPKYCIELSAQPVGLIRVHKVLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRDKALLNVI |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 582 |
Más información
Human BBS1 full-length ORF ( AAH47642.1, 1 a.a. - 463 a.a.) recombinant protein with GST-tag at N-terminal.