ATP4A (Human) Recombinant Protein
  • ATP4A (Human) Recombinant Protein

ATP4A (Human) Recombinant Protein

Ref: AB-H00000495-G01
ATP4A (Human) Recombinant Protein

Información del producto

Human ATP4A full-length ORF (AAI67780.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name ATP4A
Gene Alias ATP6A
Gene Description ATPase, H+/K+ exchanging, alpha polypeptide
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MGKAENYELYSVELGPGPGGDMAAKMSKKKKAGGGGGKRKEKLENMKKEMEINDHQLSVAELEQKYQTSATKGLSASLAAELLLRDGPNALRPPRGTPEYVKFARQLAGGLQCLMWVAAAICLIAFAIQASEGDLTTDDNLYLAIALIAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQATVIRDGDKFQINADQLVVGDLVEMKGGDRVPADIRILAAQGCKVDNSSLTGESEPQTRSPECTHESPLETRNIAF
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 495

Enviar un mensaje


ATP4A (Human) Recombinant Protein

ATP4A (Human) Recombinant Protein