Ver mas grande
ATP1B3 (Human) Recombinant Protein
AB-H00000483-G01
Producto nuevo
ATP1B3 (Human) Recombinant Protein
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | ATP1B3 |
| Gene Alias | ATPB-3|CD298|FLJ29027 |
| Gene Description | ATPase, Na+/K+ transporting, beta 3 polypeptide |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Application Key | AP |
| Immunogen Prot. Seq | MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGS |
| Form | Liquid |
| Recomended Dilution | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Antigen species Target species | Human |
| Storage Buffer | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene ID | 483 |
Más información
Human ATP1B3 full-length ORF (NP_001670.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
This product is belong to Proteoliposome (PL).