ATP1B3 (Human) Recombinant Protein
  • ATP1B3 (Human) Recombinant Protein

ATP1B3 (Human) Recombinant Protein

Ref: AB-H00000483-G01
ATP1B3 (Human) Recombinant Protein

Información del producto

Human ATP1B3 full-length ORF (NP_001670.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name ATP1B3
Gene Alias ATPB-3|CD298|FLJ29027
Gene Description ATPase, Na+/K+ transporting, beta 3 polypeptide
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGS
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 483

Enviar un mensaje


ATP1B3 (Human) Recombinant Protein

ATP1B3 (Human) Recombinant Protein