FASLG (Human) Recombinant Protein
  • FASLG (Human) Recombinant Protein

FASLG (Human) Recombinant Protein

Ref: AB-H00000356-G01
FASLG (Human) Recombinant Protein

Información del producto

Human FASLG full-length ORF (AAH17502.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name FASLG
Gene Alias APT1LG1|CD178|CD95L|FASL|TNFSF6
Gene Description Fas ligand (TNF superfamily, member 6)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSAD
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 356

Enviar un mensaje


FASLG (Human) Recombinant Protein

FASLG (Human) Recombinant Protein