SLC25A4 (Human) Recombinant Protein (P01)
  • SLC25A4 (Human) Recombinant Protein (P01)

SLC25A4 (Human) Recombinant Protein (P01)

Ref: AB-H00000291-P01
2 ug

Información del producto

SLC25A4 (Human) Recombinant Protein (P01)
Información adicional
Size 2 ug
Gene Name SLC25A4
Gene Alias AAC1|ANT|ANT1|PEO2|PEO3|T1
Gene Description solute carrier family 25 (mitochondrial carrier
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTV
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 291

Enviar un mensaje


SLC25A4 (Human) Recombinant Protein (P01)

SLC25A4 (Human) Recombinant Protein (P01)