APLNR (Human) Recombinant Protein
  • APLNR (Human) Recombinant Protein

APLNR (Human) Recombinant Protein

Ref: AB-H00000187-G01
APLNR (Human) Recombinant Protein

Información del producto

Human APLNR full-length ORF (ABM81770.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name APLNR
Gene Alias AGTRL1|APJ|APJR|FLJ90771|MGC45246
Gene Description apelin receptor
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVV
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 187

Enviar un mensaje


APLNR (Human) Recombinant Protein

APLNR (Human) Recombinant Protein