ADRB2 (Human) Recombinant Protein
  • ADRB2 (Human) Recombinant Protein

ADRB2 (Human) Recombinant Protein

Ref: AB-H00000154-G01
ADRB2 (Human) Recombinant Protein

Información del producto

Human ADRB2 full-length ORF (NP_000015.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name ADRB2
Gene Alias ADRB2R|ADRBR|B2AR|BAR|BETA2AR
Gene Description adrenergic, beta-2-, receptor, surface
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MGQPGNGSAFLLAPNRSHAPDHDVTQQRDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCYANETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTG
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 154

Enviar un mensaje


ADRB2 (Human) Recombinant Protein

ADRB2 (Human) Recombinant Protein