ADORA3 (Human) Recombinant Protein
  • ADORA3 (Human) Recombinant Protein

ADORA3 (Human) Recombinant Protein

Ref: AB-H00000140-G01
ADORA3 (Human) Recombinant Protein

Información del producto

Human ADORA3 full-length ORF (NP_000668.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name ADORA3
Gene Alias A3AR|AD026|bA552M11.5
Gene Description adenosine A3 receptor
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIAVGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKRVTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFALSWLPLSIINCIIYF
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 140

Enviar un mensaje


ADORA3 (Human) Recombinant Protein

ADORA3 (Human) Recombinant Protein