Anti-RRN3 Antibody 25ul
  • Anti-RRN3 Antibody 25ul

Anti-RRN3 Antibody 25ul

Ref: AN-HPA049837-25ul
Anti-RRN3

Información del producto

Polyclonal Antibody against Human RRN3, Gene description: RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae), Alternative Gene Names: DKFZp566E104, Validated applications: ICC, Uniprot ID: Q9NYV6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RRN3
Gene Description RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence KDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSV
Immunogen KDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSV
Product Group Polyclonal Antibodies
Alternative Names DKFZp566E104
Host RABBIT
UniProt ID Q9NYV6
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RRN3 Antibody 25ul

Anti-RRN3 Antibody 25ul