Ver mas grande
Anti-CLU Antibody 100ul
AN-HPA075983-100ul
Producto nuevo
Anti-CLU
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100ul |
| Gene Name | CLU |
| Gene Description | clusterin |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | ICC, WB |
| Sequence | KEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDH |
| Immunogen | KEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDH |
| Product Group | Polyclonal Antibodies |
| Alternative Names | APOJ, CLI, CLU1, CLU2, KUB1, SGP-2, SP-40, TRPM-2 |
| Categoria | Polyclonal |
| Host | RABBIT |
| UniProt ID | P10909 |
| HTS Code | 3002150000 |
| Gene ID | 1191 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicación | WB, ICC |
| Conjugation | Unconjugated |
Más información
Polyclonal Antibody against Human CLU, Gene description: clusterin, Alternative Gene Names: APOJ, CLI, CLU1, CLU2, KUB1, SGP-2, SP-40, TRPM-2, Validated applications: ICC, WB, Uniprot ID: P10909, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF