Anti-ASAP2
  • Anti-ASAP2

Anti-ASAP2 Antibody 100ul

Ref: AN-HPA068383-100ul
Anti-ASAP2

Información del producto

Polyclonal Antibody against Human ASAP2, Gene description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 2, Alternative Gene Names: CENTB3, DDEF2, KIAA0400, PAP, SHAG1, Validated applications: ICC, Uniprot ID: O43150, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ASAP2
Gene Description ArfGAP with SH3 domain, ankyrin repeat and PH domain 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross HUMAN
Applications ICC
Sequence WRLLHEDLDESDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKDKQRAFMPSILQNETY
Immunogen WRLLHEDLDESDDDMDEKLQPSPNRREDRPISFYQLGSNQLQSNAVSLARDAANLAKDKQRAFMPSILQNETY
Product Group Polyclonal Antibodies
Alternative Names CENTB3, DDEF2, KIAA0400, PAP, SHAG1
Categoria Polyclonal
Host RABBIT
UniProt ID O43150
HTS Code 3002150000
Gene ID 8853
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ASAP2 Antibody 100ul

Anti-ASAP2 Antibody 100ul