Ver mas grande
Anti-CD1C Antibody 100ul
AN-HPA068359-100ul
Producto nuevo
Anti-CD1C
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Hoja técnica
| Size | 100ul |
| Gene Name | CD1C |
| Gene Description | CD1c molecule |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | WB, ICC |
| Sequence | NFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVA |
| Immunogen | NFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVA |
| Product Group | Polyclonal Antibodies |
| Alternative Names | CD1 |
| Categoria | Polyclonal |
| Host | RABBIT |
| UniProt ID | P29017 |
| HTS Code | 3002150000 |
| Gene ID | 911 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicación | ICC, WB |
| Conjugation | Unconjugated |
Más información
Polyclonal Antibody against Human CD1C, Gene description: CD1c molecule, Alternative Gene Names: CD1, Validated applications: ICC, WB, Uniprot ID: P29017, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF