Anti-CYP11B2
  • Anti-CYP11B2

Anti-CYP11B2 Antibody 100ul

Ref: AN-HPA049565-100ul
Anti-CYP11B2

Información del producto

Polyclonal Antibody against Human CYP11B2, Gene description: cytochrome P450 family 11 subfamily B member 2, Alternative Gene Names: ALDOS, CPN2, CYP11B, CYP11BL, P-450C18, P450aldo, Validated applications: ICC, Uniprot ID: P19099, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CYP11B2
Gene Description cytochrome P450 family 11 subfamily B member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross HUMAN
Applications ICC
Sequence WVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLS
Immunogen WVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLS
Product Group Polyclonal Antibodies
Alternative Names ALDOS, CPN2, CYP11B, CYP11BL, P-450C18, P450aldo
Categoria Polyclonal
Host RABBIT
UniProt ID P19099
HTS Code 3002150000
Gene ID 1585
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CYP11B2 Antibody 100ul

Anti-CYP11B2 Antibody 100ul