Anti-PWWP2B Ver mas grande

Anti-PWWP2B Antibody 100ul

AN-HPA078118-100ul

Producto nuevo

Anti-PWWP2B

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 100ul
Gene Name PWWP2B
Gene Description PWWP domain containing 2B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence VRVEQVVNGALVVTVSCGERSFAGILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQL
Immunogen VRVEQVVNGALVVTVSCGERSFAGILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQL
Product Group Polyclonal Antibodies
Alternative Names bA432J24.1, FLJ46823, PWWP2
Categoria Polyclonal
Host RABBIT
UniProt ID Q6NUJ5
HTS Code 3002150000
Gene ID 170394
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación WB, IHC
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human PWWP2B, Gene description: PWWP domain containing 2B, Alternative Gene Names: bA432J24.1, FLJ46823, PWWP2, Validated applications: IHC, WB, Uniprot ID: Q6NUJ5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image