Anti-ZSCAN10 Ver mas grande

Anti-ZSCAN10 Antibody 25ul

AN-HPA076826-25ul

Producto nuevo

Anti-ZSCAN10

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 25ul
Gene Name ZSCAN10
Gene Description zinc finger and SCAN domain containing 10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PSPWPEESSRDQELAAVLECLTFEDVPENKAWPAHPLGFGSRTPDKEEFKQEEPKGAAWPTPILAESQAD
Immunogen PSPWPEESSRDQELAAVLECLTFEDVPENKAWPAHPLGFGSRTPDKEEFKQEEPKGAAWPTPILAESQAD
Product Group Polyclonal Antibodies
Alternative Names ZNF206
Categoria Polyclonal
Host RABBIT
UniProt ID Q96SZ4
HTS Code 3002150000
Gene ID 84891
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación ICC
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human ZSCAN10, Gene description: zinc finger and SCAN domain containing 10, Alternative Gene Names: ZNF206, Validated applications: ICC, Uniprot ID: Q96SZ4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image