Anti-ZBTB45 Ver mas grande

Anti-ZBTB45 Antibody 25ul

AN-HPA075485-25ul

Producto nuevo

Anti-ZBTB45

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 25ul
Gene Name ZBTB45
Gene Description zinc finger and BTB domain containing 45
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence APPSFPDCAAGFLTAAADSACEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSYVSTWH
Immunogen APPSFPDCAAGFLTAAADSACEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSYVSTWH
Product Group Polyclonal Antibodies
Alternative Names FLJ14486, ZNF499
Categoria Polyclonal
Host RABBIT
UniProt ID Q96K62
HTS Code 3002150000
Gene ID 84878
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación ICC
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human ZBTB45, Gene description: zinc finger and BTB domain containing 45, Alternative Gene Names: FLJ14486, ZNF499, Validated applications: ICC, Uniprot ID: Q96K62, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image