Anti-ANXA10 Ver mas grande

Anti-ANXA10 Antibody 100ul

AN-HPA074650-100ul

Producto nuevo

Anti-ANXA10

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 100ul
Gene Name ANXA10
Gene Description annexin A10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence MFCGDYVQGTIFPAPNFNPIMDAQMLGGALQGFDCDKDMLINILTQRCNAQRMMIAEAYQSMYGRDLIGDLREQLSDHFKDVMAG
Immunogen MFCGDYVQGTIFPAPNFNPIMDAQMLGGALQGFDCDKDMLINILTQRCNAQRMMIAEAYQSMYGRDLIGDLREQLSDHFKDVMAG
Product Group Polyclonal Antibodies
Alternative Names ANX14
Categoria Polyclonal
Host RABBIT
UniProt ID Q9UJ72
HTS Code 3002150000
Gene ID 11199
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación IHC, WB
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human ANXA10, Gene description: annexin A10, Alternative Gene Names: ANX14, Validated applications: IHC, WB, Uniprot ID: Q9UJ72, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image