Anti-HERC2
  • Anti-HERC2

Anti-HERC2 Antibody 100ul

Ref: AN-HPA074166-100ul
Anti-HERC2

Información del producto

Polyclonal Antibody against Human HERC2, Gene description: HECT and RLD domain containing E3 ubiquitin protein ligase 2, Alternative Gene Names: D15F37S1, jdf2, p528, Validated applications: ICC, WB, Uniprot ID: O95714, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HERC2
Gene Description HECT and RLD domain containing E3 ubiquitin protein ligase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence AQVPMEYNHLQEIPIIALRNRLLLLHHLSELFCPCIPMFDLEGSLDETGLGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSK
Immunogen AQVPMEYNHLQEIPIIALRNRLLLLHHLSELFCPCIPMFDLEGSLDETGLGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSK
Product Group Polyclonal Antibodies
Alternative Names D15F37S1, jdf2, p528
Categoria Polyclonal
Host RABBIT
UniProt ID O95714
HTS Code 3002150000
Gene ID 8924
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HERC2 Antibody 100ul

Anti-HERC2 Antibody 100ul