Ver mas grande
Anti-LIMK1 Antibody 25ul
AN-HPA073571-25ul
Producto nuevo
Anti-LIMK1
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 25ul |
| Gene Name | LIMK1 |
| Gene Description | LIM domain kinase 1 |
| Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Shipping Conditions | Normally shipped at ambient temperature |
| Species Reactivity Cross | Human |
| Applications | IHC, WB |
| Sequence | MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGL |
| Immunogen | MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGL |
| Product Group | Polyclonal Antibodies |
| Alternative Names | LIMK |
| Categoria | Polyclonal |
| Host | RABBIT |
| UniProt ID | P53667 |
| HTS Code | 3002150000 |
| Gene ID | 3984 |
| Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
| Iso type | IgG |
| Aplicación | IHC, WB |
| Conjugation | Unconjugated |
Más información
Polyclonal Antibody against Human LIMK1, Gene description: LIM domain kinase 1, Alternative Gene Names: LIMK, Validated applications: IHC, WB, Uniprot ID: P53667, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C." target="_blank">See DataSheet herehttps://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF