Anti-TAF9
  • Anti-TAF9

Anti-TAF9 Antibody 25ul

Ref: AN-HPA072658-25ul
Anti-TAF9

Información del producto

Polyclonal Antibody against Human TAF9, Gene description: TATA-box binding protein associated factor 9, Alternative Gene Names: AD-004, CGI-137, MGC1603, MGC3647, MGC5067, TAF2G, TAFII31, TAFII32, TAFIID32, Validated applications: IHC, Uniprot ID: Q16594, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TAF9
Gene Description TATA-box binding protein associated factor 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTG
Immunogen ASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTG
Product Group Polyclonal Antibodies
Alternative Names AD-004, CGI-137, MGC1603, MGC3647, MGC5067, TAF2G, TAFII31, TAFII32, TAFIID32
Categoria Polyclonal
Host RABBIT
UniProt ID Q16594
HTS Code 3002150000
Gene ID 6880
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TAF9 Antibody 25ul

Anti-TAF9 Antibody 25ul