Anti-CACNA1A
  • Anti-CACNA1A

Anti-CACNA1A Antibody 25ul

Ref: AN-HPA068138-25ul
Anti-CACNA1A

Información del producto

Polyclonal Antibody against Human CACNA1A, Gene description: calcium voltage-gated channel subunit alpha1 A, Alternative Gene Names: APCA, CACNL1A4, Cav2.1, EA2, FHM, HPCA, MHP, MHP1, SCA6, Validated applications: IHC, Uniprot ID: O00555, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CACNA1A
Gene Description calcium voltage-gated channel subunit alpha1 A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence APATYEGDARREDKERRHRRRKENQGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESAAPHGSLGHAGLPQSPAKMGNRTDP
Immunogen APATYEGDARREDKERRHRRRKENQGSGVPVSGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESAAPHGSLGHAGLPQSPAKMGNRTDP
Product Group Polyclonal Antibodies
Alternative Names APCA, CACNL1A4, Cav2.1, EA2, FHM, HPCA, MHP, MHP1, SCA6
Categoria Polyclonal
Host RABBIT
UniProt ID O00555
HTS Code 3002150000
Gene ID 773
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CACNA1A Antibody 25ul

Anti-CACNA1A Antibody 25ul